![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.5: MurCD N-terminal domain [51983] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; incomplete Rossmann-like fold; binds UDP group |
![]() | Superfamily c.5.1: MurCD N-terminal domain [51984] (2 families) ![]() |
![]() | Family c.5.1.0: automated matches [254240] (1 protein) not a true family |
![]() | Protein automated matches [254548] (7 species) not a true protein |
![]() | Species Pseudomonas aeruginosa [TaxId:208964] [334946] (3 PDB entries) |
![]() | Domain d6x9fg1: 6x9f G:9-96 [393250] Other proteins in same PDB: d6x9fa2, d6x9fa3, d6x9fb2, d6x9fb3, d6x9fc2, d6x9fc3, d6x9fd2, d6x9fd3, d6x9fe2, d6x9fe3, d6x9ff2, d6x9ff3, d6x9fg2, d6x9fg3, d6x9fh2, d6x9fh3 automated match to d4hv4a1 complexed with cl, dms, edo, uxp |
PDB Entry: 6x9f (more details), 2.35 Å
SCOPe Domain Sequences for d6x9fg1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6x9fg1 c.5.1.0 (G:9-96) automated matches {Pseudomonas aeruginosa [TaxId: 208964]} rrihfvgiggagmcgiaevllnlgyevsgsdlkasavterlekfgaqifighqaenadga dvlvvssainranpevasalerripvvp
Timeline for d6x9fg1: