SCOP 1.67: Domain d1cqna_: 1cqn A:

Lineage for d1cqna_ (1cqn A:)

1. Root: SCOP 1.67

2. Class d: Alpha and beta proteins (a+b) [53931] (260 folds)

3. Fold d.58: Ferredoxin-like [54861] (48 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.14: Ribosomal protein S6 [54995] (1 family)

5. Family d.58.14.1: Ribosomal protein S6 [54996] (1 protein)

6. Protein Ribosomal protein S6 [54997] (1 species)

7. Species Thermus thermophilus [TaxId:274] [54998] (20 PDB entries)

8. Domain d1cqna_: 1cqn A: [39324]

Details for d1cqna_

PDB Entry: 1cqn, 2.1 Å

PDB Description: protein aggregation and alzheimer's disease: crystallographic analysis of the phenomenon. engineered version of the ribosomal protein s6 used as a stable scaffold to study oligomerization.

SCOP Domain Sequences for d1cqna_:

Sequence; same for both SEQRES and ATOM records:

>d1cqna_ d.58.14.1 (A:) Ribosomal protein S6 {Thermus thermophilus}
mrryevnivlnpnldqsqlalekeiiqralenygarvekvailglrrlaypiakdpqgyf
lwyqvempedrvndlarelrirdnvrrvmvvksqepfl

Timeline for d1cqna_:

• d1cqna_ first appeared (with stable ids) in SCOP 1.55
  
• d1cqna_ appears in SCOP 1.65
  
• d1cqna_ appears in SCOP 1.69
  
• d1cqna_ appears in the current release, SCOPe 2.07