Lineage for d1loua_ (1lou A:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1413688Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1416810Superfamily d.58.14: Ribosomal protein S6 [54995] (1 family) (S)
  5. 1416811Family d.58.14.1: Ribosomal protein S6 [54996] (1 protein)
  6. 1416812Protein Ribosomal protein S6 [54997] (4 species)
  7. 1416842Species Thermus thermophilus [TaxId:274] [54998] (53 PDB entries)
    Uniprot P23370
  8. 1416843Domain d1loua_: 1lou A: [39323]

Details for d1loua_

PDB Entry: 1lou (more details), 1.95 Å

PDB Description: ribosomal protein s6
PDB Compounds: (A:) ribosomal protein s6

SCOPe Domain Sequences for d1loua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1loua_ d.58.14.1 (A:) Ribosomal protein S6 {Thermus thermophilus [TaxId: 274]}
mrryevnivlnpnldqsqlalekeiiqraaenygarvekveelglrrlaypiakdpqgyf
lwyqvempedrvndlarelrirdnvrrvmvvksqepf

SCOPe Domain Coordinates for d1loua_:

Click to download the PDB-style file with coordinates for d1loua_.
(The format of our PDB-style files is described here.)

Timeline for d1loua_: