| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.72: Ribokinase-like [53612] (3 superfamilies) core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest potential superfamily: members of this fold have similar functions but different ATP-binding sites |
Superfamily c.72.2: MurD-like peptide ligases, catalytic domain [53623] (3 families) ![]() has extra strand located between strands 1 and 2 |
| Family c.72.2.0: automated matches [254328] (1 protein) not a true family |
| Protein automated matches [254749] (4 species) not a true protein |
| Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [271624] (6 PDB entries) |
| Domain d6x9nd2: 6x9n D:104-319 [393218] Other proteins in same PDB: d6x9na1, d6x9na3, d6x9nb1, d6x9nb3, d6x9nc1, d6x9nc3, d6x9nd1, d6x9nd3, d6x9ne1, d6x9ne3, d6x9nf1, d6x9nf3, d6x9ng1, d6x9ng3, d6x9nh1, d6x9nh3 automated match to d4hv4a2 complexed with cl, dms, edo, uyd, val |
PDB Entry: 6x9n (more details), 2.25 Å
SCOPe Domain Sequences for d6x9nd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6x9nd2 c.72.2.0 (D:104-319) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
raemlaelmryrhgiavagthgkttttsliasvfaaggldptfviggrlnaagtnaqlga
srylvaeadesdasflhlqpmvavvtnidadhmatyggdfnklkktfveflhnlpfygla
vmcvddpvvreilpqiarptvtyglsedadvrainirqegmrtwftvlrperepldvsvn
mpglhnvlnslativiatdegisdeaivqglsgfqg
Timeline for d6x9nd2: