Lineage for d1cqma_ (1cqm A:)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.58: Ferredoxin-like [54861] (36 superfamilies) 
Superfamily d.58.14: Ribosomal protein S6 [54995] (1 family) 
Family d.58.14.1: Ribosomal protein S6 [54996] (1 protein) Protein Ribosomal protein S6 [54997] (1 species) Species Thermus thermophilus [TaxId:274] [54998] (12 PDB entries) 
Domain d1cqma_: 1cqm A: [39321]
Details for d1cqma_
PDB Entry: 1cqm (more details), 1.65 Å
PDB Description: protein aggregation and alzheimer's disease: crystallographic analysis of the phenomenon. engineered version of the ribosomal protein s6 used as a stable scaffold to study oligomerization.
SCOP Domain Sequences for d1cqma_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cqma_ d.58.14.1 (A:) Ribosomal protein S6 {Thermus thermophilus}
mrryevnivlnpnldqsqlalekeiiqralenygarvekvailglrrlaypiakdpqgyf
lwyqvempedrvndlarelrirdnvrrvmvvksqepfl
SCOP Domain Coordinates for d1cqma_:
Click to download the PDB-style file with coordinates for d1cqma_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1cqma_:
- d1cqma_ appears in SCOP 1.57
- d1cqma_ appears in the current release, SCOPe 2.08
View in 3D
