Lineage for d6x4ba2 (6x4b A:430-555)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2491249Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2493668Superfamily c.55.3: Ribonuclease H-like [53098] (16 families) (S)
    consists of one domain of this fold
  5. 2495032Family c.55.3.0: automated matches [191357] (1 protein)
    not a true family
  6. 2495033Protein automated matches [190396] (40 species)
    not a true protein
  7. 2495196Species Human immunodeficiency virus type 1 group m subtype b [TaxId:11678] [261468] (27 PDB entries)
  8. 2495207Domain d6x4ba2: 6x4b A:430-555 [393195]
    Other proteins in same PDB: d6x4ba1, d6x4bb_
    automated match to d1dloa1
    complexed with mg, so4, umy

Details for d6x4ba2

PDB Entry: 6x4b (more details), 2.5 Å

PDB Description: crystal structure of hiv-1 reverse transcriptase in complex with 7-(2- (2-(2,4-dioxo-3,4-dihydropyrimidin-1(2h)-yl)ethoxy)phenoxy)-5-fluoro- 8-methyl-2-naphthonitrile (jlj655), a non-nucleoside inhibitor
PDB Compounds: (A:) Reverse transcriptase/ribonuclease H

SCOPe Domain Sequences for d6x4ba2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6x4ba2 c.55.3.0 (A:430-555) automated matches {Human immunodeficiency virus type 1 group m subtype b [TaxId: 11678]}
ekepivgaetfyvdgaanretklgkagyvtnkgrqkvvpltnttnqktelqaiylalqds
glevnivtdsqyalgiiqaqpdkseselvnqiieqlikkekvylawvpahkgiggneqvd
klvsag

SCOPe Domain Coordinates for d6x4ba2:

Click to download the PDB-style file with coordinates for d6x4ba2.
(The format of our PDB-style files is described here.)

Timeline for d6x4ba2:

View in 3D
Domains from same chain:
(mouse over for more information)
d6x4ba1
View in 3D
Domains from other chains:
(mouse over for more information)
d6x4bb_