Lineage for d6x5xa_ (6x5x A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2963580Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2963581Superfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families) (S)
  5. 2964135Family d.92.1.9: Reprolysin-like [55519] (3 proteins)
    Pfam PF01421
  6. 2964171Protein automated matches [190837] (3 species)
    not a true protein
  7. 2964174Species Bothrops moojeni [TaxId:98334] [189045] (2 PDB entries)
  8. 2964176Domain d6x5xa_: 6x5x A: [393184]
    automated match to d2w15a_
    complexed with ca, pg4, so4, zn

Details for d6x5xa_

PDB Entry: 6x5x (more details), 1.92 Å

PDB Description: crystal structure o bmoomp-i, a p-i metalloproteinase from bothrops moojeni
PDB Compounds: (A:) Snake venom metalloproteinase BmooMP-I

SCOPe Domain Sequences for d6x5xa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6x5xa_ d.92.1.9 (A:) automated matches {Bothrops moojeni [TaxId: 98334]}
afspryielavvadngmftkynsnlntirtrvhemvntvngfyssvnanaslanlqvwsi
kdlikvekdsnktltsfgewrerdllprishdhaqllttivfdnyvigrsrsgkmcdpeq
svgvvrdhsknnlwvavtmahelghnldmhhddtcscgakscimasvlsktksyafstcs
qneyqtfltkhnpqcilnep

SCOPe Domain Coordinates for d6x5xa_:

Click to download the PDB-style file with coordinates for d6x5xa_.
(The format of our PDB-style files is described here.)

Timeline for d6x5xa_: