Lineage for d1hnzf_ (1hnz F:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 503917Fold d.58: Ferredoxin-like [54861] (49 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 504937Superfamily d.58.14: Ribosomal protein S6 [54995] (1 family) (S)
  5. 504938Family d.58.14.1: Ribosomal protein S6 [54996] (1 protein)
  6. 504939Protein Ribosomal protein S6 [54997] (1 species)
  7. 504940Species Thermus thermophilus [TaxId:274] [54998] (20 PDB entries)
  8. 504950Domain d1hnzf_: 1hnz F: [39318]
    Other proteins in same PDB: d1hnzb_, d1hnzc1, d1hnzc2, d1hnzd_, d1hnze1, d1hnze2, d1hnzg_, d1hnzh_, d1hnzi_, d1hnzj_, d1hnzk_, d1hnzl_, d1hnzm_, d1hnzn_, d1hnzo_, d1hnzp_, d1hnzq_, d1hnzr_, d1hnzs_, d1hnzt_, d1hnzv_

Details for d1hnzf_

PDB Entry: 1hnz (more details), 3.3 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit in complex with hygromycin b

SCOP Domain Sequences for d1hnzf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hnzf_ d.58.14.1 (F:) Ribosomal protein S6 {Thermus thermophilus}
mrryevnivlnpnldqsqlalekeiiqralenygarvekveelglrrlaypiakdpqgyf
lwyqvempedrvndlarelrirdnvrrvmvvksqepflana

SCOP Domain Coordinates for d1hnzf_:

Click to download the PDB-style file with coordinates for d1hnzf_.
(The format of our PDB-style files is described here.)

Timeline for d1hnzf_: