Class d: Alpha and beta proteins (a+b) [53931] (224 folds) |
Fold d.58: Ferredoxin-like [54861] (44 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.14: Ribosomal protein S6 [54995] (1 family) |
Family d.58.14.1: Ribosomal protein S6 [54996] (1 protein) |
Protein Ribosomal protein S6 [54997] (1 species) |
Species Thermus thermophilus [TaxId:274] [54998] (20 PDB entries) |
Domain d1hnzf_: 1hnz F: [39318] Other proteins in same PDB: d1hnzb_, d1hnzc1, d1hnzc2, d1hnzd_, d1hnze1, d1hnze2, d1hnzg_, d1hnzh_, d1hnzi_, d1hnzj_, d1hnzk_, d1hnzl_, d1hnzm_, d1hnzn_, d1hnzo_, d1hnzp_, d1hnzq_, d1hnzr_, d1hnzs_, d1hnzt_, d1hnzv_ complexed with hyg, mg, zn |
PDB Entry: 1hnz (more details), 3.3 Å
SCOP Domain Sequences for d1hnzf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hnzf_ d.58.14.1 (F:) Ribosomal protein S6 {Thermus thermophilus} mrryevnivlnpnldqsqlalekeiiqralenygarvekveelglrrlaypiakdpqgyf lwyqvempedrvndlarelrirdnvrrvmvvksqepflana
Timeline for d1hnzf_: