Lineage for d1hr0f_ (1hr0 F:)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 257061Fold d.58: Ferredoxin-like [54861] (44 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 257746Superfamily d.58.14: Ribosomal protein S6 [54995] (1 family) (S)
  5. 257747Family d.58.14.1: Ribosomal protein S6 [54996] (1 protein)
  6. 257748Protein Ribosomal protein S6 [54997] (1 species)
  7. 257749Species Thermus thermophilus [TaxId:274] [54998] (20 PDB entries)
  8. 257754Domain d1hr0f_: 1hr0 F: [39317]
    Other proteins in same PDB: d1hr0b_, d1hr0c1, d1hr0c2, d1hr0d_, d1hr0e1, d1hr0e2, d1hr0g_, d1hr0h_, d1hr0i_, d1hr0j_, d1hr0k_, d1hr0l_, d1hr0m_, d1hr0n_, d1hr0o_, d1hr0p_, d1hr0q_, d1hr0r_, d1hr0s_, d1hr0t_, d1hr0v_, d1hr0w_
    complexed with mg, zn

Details for d1hr0f_

PDB Entry: 1hr0 (more details), 3.2 Å

PDB Description: crystal structure of initiation factor if1 bound to the 30s ribosomal subunit

SCOP Domain Sequences for d1hr0f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hr0f_ d.58.14.1 (F:) Ribosomal protein S6 {Thermus thermophilus}
mrryevnivlnpnldqsqlalekeiiqralenygarvekveelglrrlaypiakdpqgyf
lwyqvempedrvndlarelrirdnvrrvmvvksqepflana

SCOP Domain Coordinates for d1hr0f_:

Click to download the PDB-style file with coordinates for d1hr0f_.
(The format of our PDB-style files is described here.)

Timeline for d1hr0f_: