Lineage for d1fjgf_ (1fjg F:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1650133Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1653465Superfamily d.58.14: Ribosomal protein S6 [54995] (1 family) (S)
  5. 1653466Family d.58.14.1: Ribosomal protein S6 [54996] (1 protein)
  6. 1653467Protein Ribosomal protein S6 [54997] (4 species)
  7. 1653497Species Thermus thermophilus [TaxId:274] [54998] (53 PDB entries)
    Uniprot P23370
  8. 1653508Domain d1fjgf_: 1fjg F: [39316]
    Other proteins in same PDB: d1fjgb_, d1fjgc1, d1fjgc2, d1fjgd_, d1fjge1, d1fjge2, d1fjgg_, d1fjgh_, d1fjgi_, d1fjgj_, d1fjgk_, d1fjgl_, d1fjgm_, d1fjgn_, d1fjgo_, d1fjgp_, d1fjgq_, d1fjgr_, d1fjgs_, d1fjgt_, d1fjgv_
    complexed with mg, par, scm, sry, zn

Details for d1fjgf_

PDB Entry: 1fjg (more details), 3 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit in complex with the antibiotics streptomycin, spectinomycin, and paromomycin
PDB Compounds: (F:) 30S ribosomal protein S6

SCOPe Domain Sequences for d1fjgf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fjgf_ d.58.14.1 (F:) Ribosomal protein S6 {Thermus thermophilus [TaxId: 274]}
mrryevnivlnpnldqsqlalekeiiqralenygarvekveelglrrlaypiakdpqgyf
lwyqvempedrvndlarelrirdnvrrvmvvksqepflana

SCOPe Domain Coordinates for d1fjgf_:

Click to download the PDB-style file with coordinates for d1fjgf_.
(The format of our PDB-style files is described here.)

Timeline for d1fjgf_: