Lineage for d1risa_ (1ris A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1650133Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1653465Superfamily d.58.14: Ribosomal protein S6 [54995] (1 family) (S)
  5. 1653466Family d.58.14.1: Ribosomal protein S6 [54996] (1 protein)
  6. 1653467Protein Ribosomal protein S6 [54997] (4 species)
  7. 1653497Species Thermus thermophilus [TaxId:274] [54998] (53 PDB entries)
    Uniprot P23370
  8. 1653499Domain d1risa_: 1ris A: [39314]

Details for d1risa_

PDB Entry: 1ris (more details), 2 Å

PDB Description: crystal structure of the ribosomal protein s6 from thermus thermophilus
PDB Compounds: (A:) ribosomal protein s6

SCOPe Domain Sequences for d1risa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1risa_ d.58.14.1 (A:) Ribosomal protein S6 {Thermus thermophilus [TaxId: 274]}
mrryevnivlnpnldqsqlalekeiiqralenygarvekveelglrrlaypiakdpqgyf
lwyqvempedrvndlarelrirdnvrrvmvvksqepf

SCOPe Domain Coordinates for d1risa_:

Click to download the PDB-style file with coordinates for d1risa_.
(The format of our PDB-style files is described here.)

Timeline for d1risa_: