Lineage for d1ris__ (1ris -)
- Root: SCOP 1.67
Class d: Alpha and beta proteins (a+b) [53931] (260 folds) 
Fold d.58: Ferredoxin-like [54861] (48 superfamilies)
alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
Superfamily d.58.14: Ribosomal protein S6 [54995] (1 family) 
Family d.58.14.1: Ribosomal protein S6 [54996] (1 protein) Protein Ribosomal protein S6 [54997] (1 species) Species Thermus thermophilus [TaxId:274] [54998] (20 PDB entries) 
Domain d1ris__: 1ris - [39314]
Details for d1ris__
PDB Entry: 1ris (more details), 2 Å
PDB Description: crystal structure of the ribosomal protein s6 from thermus thermophilus
SCOP Domain Sequences for d1ris__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ris__ d.58.14.1 (-) Ribosomal protein S6 {Thermus thermophilus}
mrryevnivlnpnldqsqlalekeiiqralenygarvekveelglrrlaypiakdpqgyf
lwyqvempedrvndlarelrirdnvrrvmvvksqepf
SCOP Domain Coordinates for d1ris__:
Click to download the PDB-style file with coordinates for d1ris__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ris__:
- d1ris__ first appeared (with stable ids) in SCOP 1.55
- d1ris__ appears in SCOP 1.65
- d1ris__ appears in SCOP 1.69
- d1ris__ appears in the current release, SCOPe 2.07, called d1risa_
View in 3D