Lineage for d1ris__ (1ris -)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 411877Fold d.58: Ferredoxin-like [54861] (48 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 412726Superfamily d.58.14: Ribosomal protein S6 [54995] (1 family) (S)
  5. 412727Family d.58.14.1: Ribosomal protein S6 [54996] (1 protein)
  6. 412728Protein Ribosomal protein S6 [54997] (1 species)
  7. 412729Species Thermus thermophilus [TaxId:274] [54998] (20 PDB entries)
  8. 412731Domain d1ris__: 1ris - [39314]

Details for d1ris__

PDB Entry: 1ris (more details), 2 Å

PDB Description: crystal structure of the ribosomal protein s6 from thermus thermophilus

SCOP Domain Sequences for d1ris__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ris__ d.58.14.1 (-) Ribosomal protein S6 {Thermus thermophilus}
mrryevnivlnpnldqsqlalekeiiqralenygarvekveelglrrlaypiakdpqgyf
lwyqvempedrvndlarelrirdnvrrvmvvksqepf

SCOP Domain Coordinates for d1ris__:

Click to download the PDB-style file with coordinates for d1ris__.
(The format of our PDB-style files is described here.)

Timeline for d1ris__: