Lineage for d1g7cb_ (1g7c B:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555938Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2560468Superfamily d.58.12: eEF-1beta-like [54984] (1 family) (S)
    automatically mapped to Pfam PF00736
  5. 2560469Family d.58.12.1: eEF-1beta-like [54985] (3 proteins)
  6. 2560473Protein Guanine nucleotide exchange factor (GEF) domain from elongation factor-1 beta [54986] (2 species)
  7. 2560474Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [54988] (7 PDB entries)
  8. 2560477Domain d1g7cb_: 1g7c B: [39308]
    Other proteins in same PDB: d1g7ca1, d1g7ca2, d1g7ca3
    complexed with 5gp

Details for d1g7cb_

PDB Entry: 1g7c (more details), 2.05 Å

PDB Description: yeast eef1a:eef1ba in complex with gdpnp
PDB Compounds: (B:) elongation factor 1-beta

SCOPe Domain Sequences for d1g7cb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g7cb_ d.58.12.1 (B:) Guanine nucleotide exchange factor (GEF) domain from elongation factor-1 beta {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
paaksivtldvkpwddetnleemvanvkaiemegltwgahqfipigfgikklqincvved
dkvslddlqqsieededhvqstdiaamqkl

SCOPe Domain Coordinates for d1g7cb_:

Click to download the PDB-style file with coordinates for d1g7cb_.
(The format of our PDB-style files is described here.)

Timeline for d1g7cb_: