Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.12: eEF-1beta-like [54984] (1 family) |
Family d.58.12.1: eEF-1beta-like [54985] (2 proteins) |
Protein Guanine nucleotide exchange factor (GEF) domain from elongation factor-1 beta [54986] (2 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [54988] (6 PDB entries) |
Domain d1g7cb_: 1g7c B: [39308] Other proteins in same PDB: d1g7ca1, d1g7ca2, d1g7ca3 complexed with 5gp |
PDB Entry: 1g7c (more details), 2.05 Å
SCOPe Domain Sequences for d1g7cb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1g7cb_ d.58.12.1 (B:) Guanine nucleotide exchange factor (GEF) domain from elongation factor-1 beta {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} paaksivtldvkpwddetnleemvanvkaiemegltwgahqfipigfgikklqincvved dkvslddlqqsieededhvqstdiaamqkl
Timeline for d1g7cb_: