Lineage for d1b64a_ (1b64 A:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2172288Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2175889Superfamily d.58.12: eEF-1beta-like [54984] (1 family) (S)
    automatically mapped to Pfam PF00736
  5. 2175890Family d.58.12.1: eEF-1beta-like [54985] (3 protein domains)
  6. 2175894Protein Guanine nucleotide exchange factor (GEF) domain from elongation factor-1 beta [54986] (2 species)
  7. 2175902Species Human (Homo sapiens) [TaxId:9606] [54987] (1 PDB entry)
  8. 2175903Domain d1b64a_: 1b64 A: [39306]

Details for d1b64a_

PDB Entry: 1b64 (more details)

PDB Description: solution structure of the guanine nucleotide exchange factor domain from human elongation factor-one beta, nmr, 20 structures
PDB Compounds: (A:) elongation factor 1-beta

SCOPe Domain Sequences for d1b64a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b64a_ d.58.12.1 (A:) Guanine nucleotide exchange factor (GEF) domain from elongation factor-1 beta {Human (Homo sapiens) [TaxId: 9606]}
mlvakssilldvkpwddetdmakleecvrsiqadglvwgssklvpvgygikklqiqcvve
ddkvgtdmleeqitafedyvqsmdvaafnki

SCOPe Domain Coordinates for d1b64a_:

Click to download the PDB-style file with coordinates for d1b64a_.
(The format of our PDB-style files is described here.)

Timeline for d1b64a_: