SCOPe 2.08: Domain d6wn7c1: 6wn7 C:1-89

Lineage for d6wn7c1 (6wn7 C:1-89)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (12 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.0: automated matches [191396] (1 protein)
   not a true family

6. Protein automated matches [190513] (36 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189519] (58 PDB entries)

8. Domain d6wn7c1: 6wn7 C:1-89 [393045]
   Other proteins in same PDB: d6wn7a2, d6wn7c2, d6wn7e2
   automated match to d2kaya_
   complexed with ca

Details for d6wn7c1

PDB Entry: 6wn7, 1.25 Å

PDB Description: homo sapiens s100a5

PDB Compounds: (C:) Protein S100-A5

SCOPe Domain Sequences for d6wn7c1:

Sequence, based on SEQRES records:

>d6wn7c1 a.39.1.0 (C:1-89) automated matches {Human (Homo sapiens) [TaxId: 9606]}
metplekalttmvttfhkysgregskltlsrkelkelikkelslgemkessiddlmksld
knsdqeidfkeysvfltmlsmayndffle

Sequence, based on observed residues (ATOM records):

>d6wn7c1 a.39.1.0 (C:1-89) automated matches {Human (Homo sapiens) [TaxId: 9606]}
metplekalttmvttfhkysgregskltlsrkelkelikkelslgmkessiddlmksldk
nsdqeidfkeysvfltmlsmayndffle

Timeline for d6wn7c1:

• d6wn7c1 first appeared in SCOPe 2.07