SCOPe 2.08: Domain d1eloa4: 1elo A:600-689

Lineage for d1eloa4 (1elo A:600-689)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.11: EF-G C-terminal domain-like [54980] (4 families)

5. Family d.58.11.1: EF-G/eEF-2 domains III and V [54981] (5 proteins)
   domain III structure is lacking some of the superfamily characters and is often disordered in crystals

6. Protein Elongation factor G (EF-G) [54982] (2 species)
   domain III is seen in 1FNM but disordered in the most of other PDB entries

7. Species Thermus thermophilus [TaxId:274] [54983] (9 PDB entries)

8. Domain d1eloa4: 1elo A:600-689 [39304]
   Other proteins in same PDB: d1eloa1, d1eloa2, d1eloa3

Details for d1eloa4

PDB Entry: 1elo, 2.8 Å

PDB Description: elongation factor g without nucleotide

PDB Compounds: (A:) Elongation factor G

SCOPe Domain Sequences for d1eloa4:

Sequence; same for both SEQRES and ATOM records:

>d1eloa4 d.58.11.1 (A:600-689) Elongation factor G (EF-G) {Thermus thermophilus [TaxId: 274]}
vilepimrvevttpeeymgdvigdlnarrgqilgmeprgnaqvirafvplaemfgyatdl
rsktqgrgsfvmffdhyqevpkqvqeklik

Timeline for d1eloa4:

• d1eloa4 first appeared (with stable ids) in SCOP 1.55, called d1elo_4
  
• d1eloa4 appears in SCOPe 2.07