| Class d: Alpha and beta proteins (a+b) [53931] (286 folds) |
| Fold d.58: Ferredoxin-like [54861] (51 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.11: EF-G C-terminal domain-like [54980] (3 families) ![]() |
| Family d.58.11.1: EF-G/eEF-2 domains III and V [54981] (2 proteins) domain III structure is lacking some of the superfamily characters and is often disordered in crystals |
| Protein Elongation factor G (EF-G) [54982] (1 species) domain III is seen in 1FNM but disordered in the most of other PDB entries |
| Species Thermus thermophilus [TaxId:274] [54983] (6 PDB entries) |
| Domain d1dar_4: 1dar 600-689 [39300] Other proteins in same PDB: d1dar_1, d1dar_2, d1dar_3 complexed with gdp |
PDB Entry: 1dar (more details), 2.4 Å
SCOP Domain Sequences for d1dar_4:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dar_4 d.58.11.1 (600-689) Elongation factor G (EF-G) {Thermus thermophilus}
vilepimrvevttpeeymgdvigdlnarrgqilgmeprgnaqvirafvplaemfgyatdl
rsktqgrgsfvmffdhyqevpkqvqeklik
Timeline for d1dar_4: