SCOP 1.71: Domain d2acy__: 2acy -

Lineage for d2acy__ (2acy -)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.58: Ferredoxin-like [54861] (51 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.10: Acylphosphatase-like [54975] (1 family)

5. Family d.58.10.1: Acylphosphatase-like [54976] (3 proteins)

6. Protein Acylphosphatase [54977] (4 species)

7. Species Cow (Bos taurus) [TaxId:9913] [54978] (1 PDB entry)

8. Domain d2acy__: 2acy - [39298]
   complexed with cl, so4

Details for d2acy__

PDB Entry: 2acy, 1.8 Å

PDB Description: acyl-phosphatase (common type) from bovine testis

SCOP Domain Sequences for d2acy__:

Sequence; same for both SEQRES and ATOM records:

>d2acy__ d.58.10.1 (-) Acylphosphatase {Cow (Bos taurus)}
aegdtlisvdyeifgkvqgvffrkytqaegkklglvgwvqntdqgtvqgqlqgpaskvrh
mqewletkgspkshidrasfhnekvivkldytdfqivk

Timeline for d2acy__:

• d2acy__ first appeared (with stable ids) in SCOP 1.55
  
• d2acy__ appears in SCOP 1.69
  
• d2acy__ is called d2acya_ in SCOP 1.73
  
• d2acy__ appears in the current release, SCOPe 2.08, called d2acya_