Lineage for d2acy__ (2acy -)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 32366Fold d.58: Ferredoxin-like [54861] (36 superfamilies)
  4. 32837Superfamily d.58.10: Acylphosphatase [54975] (1 family) (S)
  5. 32838Family d.58.10.1: Acylphosphatase [54976] (1 protein)
  6. 32839Protein Acylphosphatase [54977] (2 species)
  7. 32840Species Cow (Bos taurus) [TaxId:9913] [54978] (1 PDB entry)
  8. 32841Domain d2acy__: 2acy - [39298]

Details for d2acy__

PDB Entry: 2acy (more details), 1.8 Å

PDB Description: acyl-phosphatase (common type) from bovine testis

SCOP Domain Sequences for d2acy__:

Sequence; same for both SEQRES and ATOM records: (download)

>d2acy__ d.58.10.1 (-) Acylphosphatase {Cow (Bos taurus)}
aegdtlisvdyeifgkvqgvffrkytqaegkklglvgwvqntdqgtvqgqlqgpaskvrh
mqewletkgspkshidrasfhnekvivkldytdfqivk

SCOP Domain Coordinates for d2acy__:

Click to download the PDB-style file with coordinates for d2acy__.
(The format of our PDB-style files is described here.)

Timeline for d2acy__: