Lineage for d2acya_ (2acy A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2953323Superfamily d.58.10: Acylphosphatase/BLUF domain-like [54975] (4 families) (S)
  5. 2953324Family d.58.10.1: Acylphosphatase-like [54976] (4 proteins)
    automatically mapped to Pfam PF00708
  6. 2953325Protein Acylphosphatase [54977] (4 species)
  7. 2953326Species Cow (Bos taurus) [TaxId:9913] [54978] (1 PDB entry)
  8. 2953327Domain d2acya_: 2acy A: [39298]
    complexed with cl, so4

Details for d2acya_

PDB Entry: 2acy (more details), 1.8 Å

PDB Description: acyl-phosphatase (common type) from bovine testis
PDB Compounds: (A:) acylphosphatase

SCOPe Domain Sequences for d2acya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2acya_ d.58.10.1 (A:) Acylphosphatase {Cow (Bos taurus) [TaxId: 9913]}
aegdtlisvdyeifgkvqgvffrkytqaegkklglvgwvqntdqgtvqgqlqgpaskvrh
mqewletkgspkshidrasfhnekvivkldytdfqivk

SCOPe Domain Coordinates for d2acya_:

Click to download the PDB-style file with coordinates for d2acya_.
(The format of our PDB-style files is described here.)

Timeline for d2acya_: