Lineage for d6w9wa2 (6w9w A:127-254)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2583354Fold d.131: DNA clamp [55978] (1 superfamily)
    contains two helices and two beta sheets
    duplication: fold has internal pseudo two-fold symmetry
  4. 2583355Superfamily d.131.1: DNA clamp [55979] (3 families) (S)
  5. 2583540Family d.131.1.2: DNA polymerase processivity factor [55983] (5 proteins)
    duplication: consists of two domains of this fold
  6. 2583562Protein Proliferating cell nuclear antigen (PCNA) [55989] (8 species)
  7. 2583570Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55990] (8 PDB entries)
    Uniprot P15873
  8. 2583574Domain d6w9wa2: 6w9w A:127-254 [392965]
    Other proteins in same PDB: d6w9wa3
    automated match to d1plqa2
    mutant

Details for d6w9wa2

PDB Entry: 6w9w (more details), 2.65 Å

PDB Description: r80a pcna mutant defective in bir
PDB Compounds: (A:) Proliferating Cell Nuclear Antigen

SCOPe Domain Sequences for d6w9wa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6w9wa2 d.131.1.2 (A:127-254) Proliferating cell nuclear antigen (PCNA) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
kieelqydstlslpssefskivrdlsqlsdsinimitketikfvadgdigsgsviikpfv
dmehpetsiklemdqpvdltfgakylldiikgsslsdrvgirlsseapalfqfdlksgfl
qfflapkf

SCOPe Domain Coordinates for d6w9wa2:

Click to download the PDB-style file with coordinates for d6w9wa2.
(The format of our PDB-style files is described here.)

Timeline for d6w9wa2: