Lineage for d6wh9d1 (6wh9 D:1448-1655)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2841375Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (73 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7

    has additional subdomain(s) that are not in the common domain
  6. 2842423Protein Erythromycin synthase, eryAI, 1st ketoreductase module, N-terminal domain [418934] (1 species)
    protein contains tandem repeat of two SDR-like modules resembling a dimer commonly found in the family; only the second module retains the coenzyme-binding site
  7. 2842424Species Saccharopolyspora erythraea [TaxId:1836] [419372] (4 PDB entries)
    Uniprot Q5UNP6
  8. 2842429Domain d6wh9d1: 6wh9 D:1448-1655 [392959]
    Other proteins in same PDB: d6wh9a2, d6wh9c1, d6wh9c2, d6wh9d2, d6wh9d3, d6wh9f1, d6wh9f2, d6wh9g2, d6wh9i1, d6wh9i2
    automated match to d2fr1a2
    complexed with so4

Details for d6wh9d1

PDB Entry: 6wh9 (more details), 2.75 Å

PDB Description: ketoreductase from module 1 of the 6-deoxyerythronolide b synthase (kr1) in complex with antibody fragment (fab) 1d10
PDB Compounds: (D:) kr1

SCOPe Domain Sequences for d6wh9d1:

Sequence, based on SEQRES records: (download)

>d6wh9d1 c.2.1.2 (D:1448-1655) Erythromycin synthase, eryAI, 1st ketoreductase module, N-terminal domain {Saccharopolyspora erythraea [TaxId: 1836]}
devsalryriewrptgageparldgtwlvakyagtadetstaarealesagarvrelvvd
arcgrdelaerlrsvgevagvlsllavdeaepeeaplalasladtlslvqamvsaelgcp
lwtvtesavatgpfervrnaahgalwgvgrvialenpavwgglvdvpagsvaelarhlaa
vvsggagedqlalradgvygrrwvraaa

Sequence, based on observed residues (ATOM records): (download)

>d6wh9d1 c.2.1.2 (D:1448-1655) Erythromycin synthase, eryAI, 1st ketoreductase module, N-terminal domain {Saccharopolyspora erythraea [TaxId: 1836]}
devsalryriewrptgagepdgtwlvakyagtadetstaarealesagarvrelvvdarc
grdelaerlrsvgevagvlsllavdeaepeeaplalasladtlslvqamvsaelgcplwt
vtesavatgpfervrnaahgalwgvgrvialenpavwgglvdvpagsvaelarhlaavvs
ggagedqlalradgvygrrwvraaa

SCOPe Domain Coordinates for d6wh9d1:

Click to download the PDB-style file with coordinates for d6wh9d1.
(The format of our PDB-style files is described here.)

Timeline for d6wh9d1: