SCOPe 2.08: Domain d6wh9f2: 6wh9 F:127-230

Lineage for d6wh9f2 (6wh9 F:127-230)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)

8. Domain d6wh9f2: 6wh9 F:127-230 [392958]
   Other proteins in same PDB: d6wh9a1, d6wh9a2, d6wh9c1, d6wh9d1, d6wh9d2, d6wh9d3, d6wh9f1, d6wh9g1, d6wh9g2, d6wh9i1
   automated match to d1aqkl2
   complexed with so4

Details for d6wh9f2

PDB Entry: 6wh9, 2.75 Å

PDB Description: ketoreductase from module 1 of the 6-deoxyerythronolide b synthase (kr1) in complex with antibody fragment (fab) 1d10

PDB Compounds: (F:) 1D10 (Fab light chain)

SCOPe Domain Sequences for d6wh9f2:

Sequence, based on SEQRES records:

>d6wh9f2 b.1.1.2 (F:127-230) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qpkaapsvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskq
snnkyaassylsltpeqwksrksyscqvthegstvektvapaec

Sequence, based on observed residues (ATOM records):

>d6wh9f2 b.1.1.2 (F:127-230) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qpkaapsvtlfppsseelqakatlvclisdfypgavtvawkadsspvkagvetttpskqs
nnkyaassylsltpeqwksrksyscqvthegstvektvapaec

Timeline for d6wh9f2:

• d6wh9f2 first appeared in SCOPe 2.07