Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (31 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries) |
Domain d6wh9f1: 6wh9 F:14-126 [392957] Other proteins in same PDB: d6wh9a1, d6wh9a2, d6wh9c2, d6wh9d1, d6wh9d2, d6wh9d3, d6wh9f2, d6wh9g1, d6wh9g2, d6wh9i2 automated match to d1aqkl1 complexed with so4 |
PDB Entry: 6wh9 (more details), 2.75 Å
SCOPe Domain Sequences for d6wh9f1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6wh9f1 b.1.1.0 (F:14-126) automated matches {Human (Homo sapiens) [TaxId: 9606]} saqtvviqepsltvspggtvtltcgsstgavtsghypywfqqkpgqaprtliydtsnkhs wtparfsgsllggkaaltlsgaqpedeaeyycllsysgalwvfgggtkltvlg
Timeline for d6wh9f1: