SCOPe 2.08: Domain d1rusb2: 1rus B:3-137

Lineage for d1rusb2 (1rus B:3-137)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (2 families)
   C-terminal domain is beta/alpha barrel

5. Family d.58.9.1: Ribulose 1,5-bisphosphate carboxylase-oxygenase [54967] (1 protein)

6. Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [54968] (13 species)

7. Species Rhodospirillum rubrum [TaxId:1085] [54974] (5 PDB entries)

8. Domain d1rusb2: 1rus B:3-137 [39295]
   Other proteins in same PDB: d1rusa1, d1rusb1
   complexed with 3pg

Details for d1rusb2

PDB Entry: 1rus, 2.9 Å

PDB Description: crystal structure of the binary complex of ribulose-1,5-bisphosphate carboxylase and its product, 3-phospho-d-glycerate

PDB Compounds: (B:) rubisco (ribulose-1,5-bisphosphate carboxylase(slash)oxygenase)

SCOPe Domain Sequences for d1rusb2:

Sequence, based on SEQRES records:

>d1rusb2 d.58.9.1 (B:3-137) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Rhodospirillum rubrum [TaxId: 1085]}
qssryvnlalkeedliaggehvlcayimkpkagygyvataahfaaesstgtnvevcttdd
ftrgvdalvyevdeareltkiaypvalfdrnitdgkamiasfltltmgnnqgmgdveyak
mhdfyvpeayralfd

Sequence, based on observed residues (ATOM records):

>d1rusb2 d.58.9.1 (B:3-137) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Rhodospirillum rubrum [TaxId: 1085]}
qssryvnlalkeedliaggehvlcayimkpkagygyvataahfaaesstgtgvdalvyev
deareltkiaypvalfdrnitdgkamiasfltltmgnnqgmgdveyakmhdfyvpeayra
lfd

Timeline for d1rusb2:

• d1rusb2 first appeared (with stable ids) in SCOP 1.55
  
• d1rusb2 appears in SCOPe 2.07