SCOPe 2.08: Domain d6wcrb_: 6wcr B:

Lineage for d6wcrb_ (6wcr B:)

1. Root: SCOPe 2.08

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
   core: trimeric coiled coil

4. Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families)

5. Family h.3.1.0: automated matches [254278] (1 protein)
   not a true family

6. Protein automated matches [254645] (42 species)
   not a true protein

7. Species Influenza A virus (strain a/puerto rico/8/1934 h1n1) [TaxId:211044] [392948] (1 PDB entry)

8. Domain d6wcrb_: 6wcr B: [392949]
   Other proteins in same PDB: d6wcra_
   automated match to d5bnyf_
   complexed with bma, nag, tu7

Details for d6wcrb_

PDB Entry: 6wcr, 2.68 Å

PDB Description: crystal structure of the a/puerto rico/8/1934 (h1n1) influenza virus hemagglutinin in complex with small molecule f0045(s)

PDB Compounds: (B:) Hemagglutinin

SCOPe Domain Sequences for d6wcrb_:

Sequence; same for both SEQRES and ATOM records:

>d6wcrb_ h.3.1.0 (B:) automated matches {Influenza A virus (strain a/puerto rico/8/1934 h1n1) [TaxId: 211044]}
glfgaiagfieggwtgmidgwygyhhqneqgsgyaadqkstqnaingitnkvntviekmn
iqftavgkefnklekrmenlnkkvddgfldiwtynaellvllenertldfhdsnvknlye
kvksqlknnakeigngcfefyhkcdnecmesvrngtydypkyseesklnre

Timeline for d6wcrb_:

• d6wcrb_ first appeared in SCOPe 2.07