Lineage for d1rusa2 (1rus A:3-137)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 32366Fold d.58: Ferredoxin-like [54861] (36 superfamilies)
  4. 32762Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (1 family) (S)
  5. 32763Family d.58.9.1: Ribulose 1,5-bisphosphate carboxylase-oxygenase [54967] (1 protein)
  6. 32764Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [54968] (6 species)
  7. 32775Species Rhodospirillum rubrum [TaxId:1085] [54974] (5 PDB entries)
  8. 32782Domain d1rusa2: 1rus A:3-137 [39294]
    Other proteins in same PDB: d1rusa1, d1rusb1

Details for d1rusa2

PDB Entry: 1rus (more details), 2.9 Å

PDB Description: crystal structure of the binary complex of ribulose-1,5-bisphosphate carboxylase and its product, 3-phospho-d-glycerate

SCOP Domain Sequences for d1rusa2:

Sequence, based on SEQRES records: (download)

>d1rusa2 d.58.9.1 (A:3-137) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Rhodospirillum rubrum}
qssryvnlalkeedliaggehvlcayimkpkagygyvataahfaaesstgtnvevcttdd
ftrgvdalvyevdeareltkiaypvalfdrnitdgkamiasfltltmgnnqgmgdveyak
mhdfyvpeayralfd

Sequence, based on observed residues (ATOM records): (download)

>d1rusa2 d.58.9.1 (A:3-137) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Rhodospirillum rubrum}
qssryvnlalkeedliaggehvlcayimkpkagygyvataahfaaesstgttrgvdalvy
evdeareltkiaypvalfdrnitdgkamiasfltltmgnnqgmgdveyakmhdfyvpeay
ralfd

SCOP Domain Coordinates for d1rusa2:

Click to download the PDB-style file with coordinates for d1rusa2.
(The format of our PDB-style files is described here.)

Timeline for d1rusa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1rusa1