Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (31 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries) |
Domain d6w9ve2: 6w9v E:117-243 [392933] Other proteins in same PDB: d6w9va1, d6w9va3, d6w9vb1, d6w9vb2, d6w9vc1, d6w9vc3, d6w9vd2, d6w9vf1, d6w9vf2, d6w9vg2 automated match to d2vlme2 complexed with act, gol |
PDB Entry: 6w9v (more details), 1.95 Å
SCOPe Domain Sequences for d6w9ve2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6w9ve2 b.1.1.0 (E:117-243) automated matches {Human (Homo sapiens) [TaxId: 9606]} dlknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpq plkeqpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqiv saeawgr
Timeline for d6w9ve2: