SCOP 1.75: Domain d9rubb2: 9rub B:2-137

Lineage for d9rubb2 (9rub B:2-137)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (1 family)
   C-terminal domain is beta/alpha barrel

5. Family d.58.9.1: Ribulose 1,5-bisphosphate carboxylase-oxygenase [54967] (1 protein)

6. Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [54968] (12 species)

7. Species Rhodospirillum rubrum [TaxId:1085] [54974] (5 PDB entries)

8. Domain d9rubb2: 9rub B:2-137 [39293]
   Other proteins in same PDB: d9ruba1, d9rubb1
   complexed with cbx, mg, rub

Details for d9rubb2

PDB Entry: 9rub, 2.6 Å

PDB Description: crystal structure of activated ribulose-1,5-bisphosphate carboxylase complexed with its substrate, ribulose-1,5-bisphosphate

PDB Compounds: (B:) ribulose-1,5-bisphosphate carboxylase

SCOP Domain Sequences for d9rubb2:

Sequence; same for both SEQRES and ATOM records:

>d9rubb2 d.58.9.1 (B:2-137) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Rhodospirillum rubrum [TaxId: 1085]}
dqssryvnlalkeedliaggehvlcayimkpkagygyvataahfaaesstgtnvevcttd
dftrgvdalvyevdeareltkiaypvalfdrnitdgkamiasfltltmgnnqgmgdveya
kmhdfyvpeayralfd

Timeline for d9rubb2:

• d9rubb2 first appeared (with stable ids) in SCOP 1.55
  
• d9rubb2 appears in SCOP 1.73
  
• d9rubb2 appears in SCOPe 2.01
  
• d9rubb2 appears in the current release, SCOPe 2.08