Lineage for d9rubb2 (9rub B:2-137)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 861003Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 862528Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (1 family) (S)
    C-terminal domain is beta/alpha barrel
  5. 862529Family d.58.9.1: Ribulose 1,5-bisphosphate carboxylase-oxygenase [54967] (1 protein)
  6. 862530Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [54968] (12 species)
  7. 862666Species Rhodospirillum rubrum [TaxId:1085] [54974] (5 PDB entries)
  8. 862674Domain d9rubb2: 9rub B:2-137 [39293]
    Other proteins in same PDB: d9ruba1, d9rubb1
    complexed with cbx, mg, rub

Details for d9rubb2

PDB Entry: 9rub (more details), 2.6 Å

PDB Description: crystal structure of activated ribulose-1,5-bisphosphate carboxylase complexed with its substrate, ribulose-1,5-bisphosphate
PDB Compounds: (B:) ribulose-1,5-bisphosphate carboxylase

SCOP Domain Sequences for d9rubb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d9rubb2 d.58.9.1 (B:2-137) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Rhodospirillum rubrum [TaxId: 1085]}
dqssryvnlalkeedliaggehvlcayimkpkagygyvataahfaaesstgtnvevcttd
dftrgvdalvyevdeareltkiaypvalfdrnitdgkamiasfltltmgnnqgmgdveya
kmhdfyvpeayralfd

SCOP Domain Coordinates for d9rubb2:

Click to download the PDB-style file with coordinates for d9rubb2.
(The format of our PDB-style files is described here.)

Timeline for d9rubb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d9rubb1