Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) |
Family d.19.1.0: automated matches [227140] (1 protein) not a true family |
Protein automated matches [226842] (5 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [226044] (107 PDB entries) |
Domain d6w9uc1: 6w9u C:1-178 [392919] Other proteins in same PDB: d6w9ua2, d6w9ua3, d6w9ub1, d6w9ub2, d6w9uc2, d6w9uc3, d6w9ud1, d6w9ud2, d6w9ue1, d6w9ue2, d6w9uf1, d6w9uf2, d6w9ug1, d6w9ug2, d6w9uh1, d6w9uh2 automated match to d4l4va1 complexed with cl, gol, tkg |
PDB Entry: 6w9u (more details), 1.89 Å
SCOPe Domain Sequences for d6w9uc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6w9uc1 d.19.1.0 (C:1-178) automated matches {Human (Homo sapiens) [TaxId: 9606]} rthslryfhlgvsdpihgvpefisvgyvdshpittydsvtrqkeprapwmaenlapdhwe rytqllrgwqqmfkvelkrlqrhynhsgshtyqrmigcelledgsttgflqyaydgqdfl ifnkdtlswlavdnvahtikqaweanqhellyqknwleeeciawlkrfleygkdtlqr
Timeline for d6w9uc1: