SCOPe 2.06: Domain d2rusa2: 2rus A:2-137

Lineage for d2rusa2 (2rus A:2-137)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (2 families)
   C-terminal domain is beta/alpha barrel

5. Family d.58.9.1: Ribulose 1,5-bisphosphate carboxylase-oxygenase [54967] (1 protein)

6. Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [54968] (12 species)

7. Species Rhodospirillum rubrum [TaxId:1085] [54974] (5 PDB entries)

8. Domain d2rusa2: 2rus A:2-137 [39290]
   Other proteins in same PDB: d2rusa1, d2rusb1
   complexed with for, mg

Details for d2rusa2

PDB Entry: 2rus, 2.3 Å

PDB Description: crystal structure of the ternary complex of ribulose-1,5-bisphosphate carboxylase, mg(ii), and activator co2 at 2.3-angstroms resolution

PDB Compounds: (A:) rubisco (ribulose-1,5-bisphosphate carboxylase(slash)oxygenase)

SCOPe Domain Sequences for d2rusa2:

Sequence, based on SEQRES records:

>d2rusa2 d.58.9.1 (A:2-137) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Rhodospirillum rubrum [TaxId: 1085]}
dqssryvnlalkeedliaggehvlcayimkpkagygyvataahfaaesstgtnvevcttd
dftrgvdalvyevdeareltkiaypvalfdrnitdgkamiasfltltmgnnqgmgdveya
kmhdfyvpeayralfd

Sequence, based on observed residues (ATOM records):

>d2rusa2 d.58.9.1 (A:2-137) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Rhodospirillum rubrum [TaxId: 1085]}
dqssryvnlalkeedliaggehvlcayimkpkagygyvataahfaaesstgtntrgvdal
vyevdeareltkiaypvalfdrnitdgkamiasfltltmgnnqgmgdveyakmhdfyvpe
ayralfd

Timeline for d2rusa2:

• d2rusa2 first appeared (with stable ids) in SCOP 1.55
  
• d2rusa2 appears in SCOPe 2.05
  
• d2rusa2 appears in SCOPe 2.07
  
• d2rusa2 appears in the current release, SCOPe 2.08