Class a: All alpha proteins [46456] (290 folds) |
Fold a.128: Terpenoid synthases [48575] (1 superfamily) multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers |
Superfamily a.128.1: Terpenoid synthases [48576] (6 families) duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J |
Family a.128.1.0: automated matches [196408] (1 protein) not a true family |
Protein automated matches [196409] (46 species) not a true protein |
Species Leishmania major [TaxId:5664] [236738] (6 PDB entries) |
Domain d6w7ia1: 6w7i A:2-362 [392899] Other proteins in same PDB: d6w7ia2, d6w7ib2 automated match to d1yhla_ complexed with 476, act, ca, ipr, peg; mutant |
PDB Entry: 6w7i (more details), 2.1 Å
SCOPe Domain Sequences for d6w7ia1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6w7ia1 a.128.1.0 (A:2-362) automated matches {Leishmania major [TaxId: 5664]} ahmerfqkvyeevqefllgdaekrfemdvhrkgylksmmdttclggkynrglcvvdvaea makdtqmdaaamervlhdacvcgwmiemlqahflveddimdhsktrrgkpcwylhpgvta qvaindglillawatqmalhyfadrpflaevlrvfhdvdlttwigqlydvtsmvdsakld akvahanttdyveytpfnhrrivvyktayytywlplvmgllvsgtlekvdkkathkvamv mgeyfqvqddvmdcftppeklgkigtdiedakcswlavtflttapaekvaefkanygstd paavavikqlyteqnllarfeeyekavvaeveqliaaleaqnaafaasvkvlwsktykrq k
Timeline for d6w7ia1: