SCOP 1.65: Domain d5rubb2: 5rub B:2-137

Lineage for d5rubb2 (5rub B:2-137)

1. Root: SCOP 1.65

2. Class d: Alpha and beta proteins (a+b) [53931] (234 folds)

3. Fold d.58: Ferredoxin-like [54861] (48 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (1 family)
   C-terminal domain is beta/alpha barrel

5. Family d.58.9.1: Ribulose 1,5-bisphosphate carboxylase-oxygenase [54967] (1 protein)

6. Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [54968] (8 species)

7. Species Rhodospirillum rubrum [TaxId:1085] [54974] (5 PDB entries)

8. Domain d5rubb2: 5rub B:2-137 [39289]
   Other proteins in same PDB: d5ruba1, d5rubb1

Details for d5rubb2

PDB Entry: 5rub, 1.7 Å

PDB Description: crystallographic refinement and structure of ribulose-1,5-bisphosphate carboxylase from rhodospirillum rubrum at 1.7 angstroms resolution

SCOP Domain Sequences for d5rubb2:

Sequence, based on SEQRES records:

>d5rubb2 d.58.9.1 (B:2-137) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Rhodospirillum rubrum}
dqssryvnlalkeedliaggehvlcayimkpkagygyvataahfaaesstgtnvevcttd
dftrgvdalvyevdeareltkiaypvalfdrnitdgkamiasfltltmgnnqgmgdveya
kmhdfyvpeayralfd

Sequence, based on observed residues (ATOM records):

>d5rubb2 d.58.9.1 (B:2-137) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Rhodospirillum rubrum}
dqssryvnlalkeedliaggehvlcayimkpkagygyvataahfaaesstgtrgvdalvy
evdeareltkiaypvalfdrnitdgkamiasfltltmgnnqgmgdveyakmhdfyvpeay
ralfd

Timeline for d5rubb2:

• d5rubb2 first appeared (with stable ids) in SCOP 1.55
  
• d5rubb2 appears in SCOP 1.63
  
• d5rubb2 appears in SCOP 1.67
  
• d5rubb2 appears in the current release, SCOPe 2.08