| Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
| Fold d.58: Ferredoxin-like [54861] (55 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (1 family) ![]() C-terminal domain is beta/alpha barrel |
| Family d.58.9.1: Ribulose 1,5-bisphosphate carboxylase-oxygenase [54967] (1 protein) |
| Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [54968] (12 species) |
| Species Synechococcus sp., strain pcc 6301 [TaxId:1131] [54973] (2 PDB entries) |
| Domain d1rsca2: 1rsc A:9-147 [39287] Other proteins in same PDB: d1rsca1, d1rscb1, d1rscc1, d1rscd1, d1rsce1, d1rscf1, d1rscg1, d1rsch1, d1rsci_, d1rscj_, d1rsck_, d1rscl_, d1rscm_, d1rscn_, d1rsco_, d1rscp_ complexed with xbp |
PDB Entry: 1rsc (more details), 2.3 Å
SCOP Domain Sequences for d1rsca2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rsca2 d.58.9.1 (A:9-147) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Synechococcus sp., strain pcc 6301 [TaxId: 1131]}
saagykagvkdykltyytpdytpkdtdllaafrfspqpgvpadeagaaiaaesstgtwtt
vwtdlltdmdrykgkcyhiepvqgeensyfafiaypldlfeegsvtniltsivgnvfgfk
airslrledirfpvalvkt
Timeline for d1rsca2: