Lineage for d1rsca2 (1rsc A:9-147)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 257061Fold d.58: Ferredoxin-like [54861] (44 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 257593Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (1 family) (S)
    C-terminal domain is beta/alpha barrel
  5. 257594Family d.58.9.1: Ribulose 1,5-bisphosphate carboxylase-oxygenase [54967] (1 protein)
  6. 257595Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [54968] (8 species)
  7. 257682Species Synechococcus sp., strain pcc 6301 [TaxId:1131] [54973] (2 PDB entries)
  8. 257684Domain d1rsca2: 1rsc A:9-147 [39287]
    Other proteins in same PDB: d1rsca1, d1rscm_
    complexed with xbp

Details for d1rsca2

PDB Entry: 1rsc (more details), 2.3 Å

PDB Description: structure of an effector induced inactivated state of ribulose bisphosphate carboxylase(slash)oxygenase: the binary complex between enzyme and xylulose bisphosphate

SCOP Domain Sequences for d1rsca2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rsca2 d.58.9.1 (A:9-147) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Synechococcus sp., strain pcc 6301}
saagykagvkdykltyytpdytpkdtdllaafrfspqpgvpadeagaaiaaesstgtwtt
vwtdlltdmdrykgkcyhiepvqgeensyfafiaypldlfeegsvtniltsivgnvfgfk
airslrledirfpvalvkt

SCOP Domain Coordinates for d1rsca2:

Click to download the PDB-style file with coordinates for d1rsca2.
(The format of our PDB-style files is described here.)

Timeline for d1rsca2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1rsca1
View in 3D
Domains from other chains:
(mouse over for more information)
d1rscm_