![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies) 4 helices, bundle; helix 3 is shorter than others; up-and-down |
![]() | Superfamily a.28.2: Colicin E immunity proteins [47345] (2 families) ![]() automatically mapped to Pfam PF01320 |
![]() | Family a.28.2.0: automated matches [273669] (1 protein) not a true family |
![]() | Protein automated matches [273670] (2 species) not a true protein |
![]() | Species Pseudomonas aeruginosa [TaxId:287] [392844] (1 PDB entry) |
![]() | Domain d6w0vb_: 6w0v B: [392845] Other proteins in same PDB: d6w0va_ automated match to d4qkoa_ mutant |
PDB Entry: 6w0v (more details), 1.38 Å
SCOPe Domain Sequences for d6w0vb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6w0vb_ a.28.2.0 (B:) automated matches {Pseudomonas aeruginosa [TaxId: 287]} skkisdhteaeffsliselfnrsfssekerdvvvyaivnaaqhpdgtdiifypkedeeds pegvlkrikewraanglpgfka
Timeline for d6w0vb_: