SCOPe 2.08: Domain d6w0vb_: 6w0v B:

Lineage for d6w0vb_ (6w0v B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
   4 helices, bundle; helix 3 is shorter than others; up-and-down

4. Superfamily a.28.2: Colicin E immunity proteins [47345] (2 families)
   automatically mapped to Pfam PF01320

5. Family a.28.2.0: automated matches [273669] (1 protein)
   not a true family

6. Protein automated matches [273670] (2 species)
   not a true protein

7. Species Pseudomonas aeruginosa [TaxId:287] [392844] (1 PDB entry)

8. Domain d6w0vb_: 6w0v B: [392845]
   Other proteins in same PDB: d6w0va_
   automated match to d4qkoa_
   mutant

Details for d6w0vb_

PDB Entry: 6w0v, 1.38 Å

PDB Description: the crystal structure of the mutant nuclease domain of pyocin s8 with its cognate immunity protein

PDB Compounds: (B:) bacteriocin immunity protein

SCOPe Domain Sequences for d6w0vb_:

Sequence; same for both SEQRES and ATOM records:

>d6w0vb_ a.28.2.0 (B:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
skkisdhteaeffsliselfnrsfssekerdvvvyaivnaaqhpdgtdiifypkedeeds
pegvlkrikewraanglpgfka

Timeline for d6w0vb_:

• d6w0vb_ first appeared in SCOPe 2.07