SCOPe 2.08: Domain d6w0va_: 6w0v A:

Lineage for d6w0va_ (6w0v A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.4: His-Me finger endonucleases [54059] (1 superfamily)
   core: (alpha)-beta-omega_loop-beta-alpha; embeded in larger different structures

4. Superfamily d.4.1: His-Me finger endonucleases [54060] (8 families)
   common motif contains conserved histidine residue and metal-binding site

5. Family d.4.1.0: automated matches [273673] (1 protein)
   not a true family

6. Protein automated matches [273674] (2 species)
   not a true protein

7. Species Pseudomonas aeruginosa [TaxId:287] [392841] (1 PDB entry)

8. Domain d6w0va_: 6w0v A: [392842]
   Other proteins in same PDB: d6w0vb_
   automated match to d4uhpa_
   mutant

Details for d6w0va_

PDB Entry: 6w0v, 1.38 Å

PDB Description: the crystal structure of the mutant nuclease domain of pyocin s8 with its cognate immunity protein

PDB Compounds: (A:) Pyocin S8

SCOPe Domain Sequences for d6w0va_:

Sequence; same for both SEQRES and ATOM records:

>d6w0va_ d.4.1.0 (A:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
depgvatgngqpvtgnwlagasqgdgvpipsqiadqlrgkefkswrdfreqfwvavandp
elvkyfrktnakgmrdglspftpkaeqaggrdkyaihhvvqisqggavydidnlrvmtpk
mhiqv

Timeline for d6w0va_:

• d6w0va_ first appeared in SCOPe 2.07