Lineage for d1bxne2 (1bxn E:22-150)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1203810Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1205860Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (1 family) (S)
    C-terminal domain is beta/alpha barrel
  5. 1205861Family d.58.9.1: Ribulose 1,5-bisphosphate carboxylase-oxygenase [54967] (1 protein)
  6. 1205862Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [54968] (12 species)
  7. 1205863Species Alcaligenes eutrophus [TaxId:106590] [54972] (1 PDB entry)
  8. 1205866Domain d1bxne2: 1bxn E:22-150 [39284]
    Other proteins in same PDB: d1bxna1, d1bxnc1, d1bxne1, d1bxng1, d1bxni_, d1bxnj_, d1bxnk_, d1bxnl_
    complexed with po4

Details for d1bxne2

PDB Entry: 1bxn (more details), 2.7 Å

PDB Description: the crystal structure of rubisco from alcaligenes eutrophus to 2.7 angstroms.
PDB Compounds: (E:) protein (ribulose bisphosphate carboxylase large chain)

SCOPe Domain Sequences for d1bxne2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bxne2 d.58.9.1 (E:22-150) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Alcaligenes eutrophus [TaxId: 106590]}
ykmgywdgdyvpkdtdllalfritpqdgvdpveaaaavagesstatwtvvwtdrltacdm
yrakayrvdpvpnnpeqffcyvaydlslfeegsianltasiignvfsfkpikaarledmr
fpvayvkt

SCOPe Domain Coordinates for d1bxne2:

Click to download the PDB-style file with coordinates for d1bxne2.
(The format of our PDB-style files is described here.)

Timeline for d1bxne2: