Lineage for d1bxne2 (1bxn E:22-150)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 411877Fold d.58: Ferredoxin-like [54861] (48 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 412559Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (1 family) (S)
    C-terminal domain is beta/alpha barrel
  5. 412560Family d.58.9.1: Ribulose 1,5-bisphosphate carboxylase-oxygenase [54967] (1 protein)
  6. 412561Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [54968] (8 species)
  7. 412562Species Alcaligenes eutrophus [TaxId:106590] [54972] (1 PDB entry)
  8. 412565Domain d1bxne2: 1bxn E:22-150 [39284]
    Other proteins in same PDB: d1bxna1, d1bxnc1, d1bxne1, d1bxng1, d1bxni_, d1bxnj_, d1bxnk_, d1bxnl_

Details for d1bxne2

PDB Entry: 1bxn (more details), 2.7 Å

PDB Description: the crystal structure of rubisco from alcaligenes eutrophus to 2.7 angstroms.

SCOP Domain Sequences for d1bxne2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bxne2 d.58.9.1 (E:22-150) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Alcaligenes eutrophus}
ykmgywdgdyvpkdtdllalfritpqdgvdpveaaaavagesstatwtvvwtdrltacdm
yrakayrvdpvpnnpeqffcyvaydlslfeegsianltasiignvfsfkpikaarledmr
fpvayvkt

SCOP Domain Coordinates for d1bxne2:

Click to download the PDB-style file with coordinates for d1bxne2.
(The format of our PDB-style files is described here.)

Timeline for d1bxne2: