![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (2 families) ![]() C-terminal domain is beta/alpha barrel |
![]() | Family d.58.9.1: Ribulose 1,5-bisphosphate carboxylase-oxygenase [54967] (1 protein) |
![]() | Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [54968] (13 species) |
![]() | Species Alcaligenes eutrophus [TaxId:106590] [54972] (1 PDB entry) |
![]() | Domain d1bxne2: 1bxn E:22-150 [39284] Other proteins in same PDB: d1bxna1, d1bxnc1, d1bxne1, d1bxng1, d1bxni_, d1bxnj_, d1bxnk_, d1bxnl_ complexed with po4 |
PDB Entry: 1bxn (more details), 2.7 Å
SCOPe Domain Sequences for d1bxne2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bxne2 d.58.9.1 (E:22-150) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Alcaligenes eutrophus [TaxId: 106590]} ykmgywdgdyvpkdtdllalfritpqdgvdpveaaaavagesstatwtvvwtdrltacdm yrakayrvdpvpnnpeqffcyvaydlslfeegsianltasiignvfsfkpikaarledmr fpvayvkt
Timeline for d1bxne2: