Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies) multi-helical domains of various folds which is thought to unfold in the membrane |
Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (2 families) PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain |
Family f.1.4.1: Bcl-2 inhibitors of programmed cell death [56855] (11 proteins) Pfam PF00452 |
Protein Apoptosis regulator Bcl-xL [56856] (3 species) |
Species Human (Homo sapiens) [TaxId:9606] [56857] (51 PDB entries) |
Domain d6vwca_: 6vwc A: [392838] automated match to d4z9vb_ complexed with rq7 |
PDB Entry: 6vwc (more details), 1.6 Å
SCOPe Domain Sequences for d6vwca_:
Sequence, based on SEQRES records: (download)
>d6vwca_ f.1.4.1 (A:) Apoptosis regulator Bcl-xL {Human (Homo sapiens) [TaxId: 9606]} sqsnrelvvdflsyklsqkgysasgggggggmaavkqalreagdefelryrrafsdltsq lhitpgtayqsfeqvvnelfrdgvnwgrivaffsfggalcvesvdkkmqvlvsriaawma tylndhlepwiqenggwatfvelyg
>d6vwca_ f.1.4.1 (A:) Apoptosis regulator Bcl-xL {Human (Homo sapiens) [TaxId: 9606]} sqsnrelvvdflsyklsqkgysasgmaavkqalreagdefelryrrafsdltsqlhitpg tayqsfeqvvnelfrdgvnwgrivaffsfggalcvesvdkkmqvlvsriaawmatylndh lepwiqenggwatfvelyg
Timeline for d6vwca_: