SCOP 1.55: Domain d1bwvg2: 1bwv G:7-149

Lineage for d1bwvg2 (1bwv G:7-149)

1. Root: SCOP 1.55

2. Class d: Alpha and beta proteins (a+b) [53931] (184 folds)

3. Fold d.58: Ferredoxin-like [54861] (36 superfamilies)

4. Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (1 family)

5. Family d.58.9.1: Ribulose 1,5-bisphosphate carboxylase-oxygenase [54967] (1 protein)

6. Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [54968] (6 species)

7. Species Galdieria partita [TaxId:83374] [54971] (1 PDB entry)

8. Domain d1bwvg2: 1bwv G:7-149 [39281]
   Other proteins in same PDB: d1bwva1, d1bwvc1, d1bwve1, d1bwvg1, d1bwvs_, d1bwvu_, d1bwvw_, d1bwvy_

Details for d1bwvg2

PDB Entry: 1bwv, 2.4 Å

PDB Description: Activated Ribulose 1,5-Bisphosphate Carboxylase/Oxygenase (RUBISCO) Complexed with the Reaction Intermediate Analogue 2-Carboxyarabinitol 1,5-Bisphosphate

SCOP Domain Sequences for d1bwvg2:

Sequence; same for both SEQRES and ATOM records:

>d1bwvg2 d.58.9.1 (G:7-149) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Galdieria partita}
riknsryesgvipyakmgywnpdyqvkdtdvlalfrvtpqpgvdpieaaaavagesstat
wtvvwtdlltaadlyrakaykvdqvpnnpeqyfayiayeldlfeegsianltasiignvf
gfkavkalrledmrlplaylktfq

Timeline for d1bwvg2:

• d1bwvg2 appears in SCOP 1.57
  
• d1bwvg2 appears in the current release, SCOPe 2.08