Lineage for d1bwvc2 (1bwv C:7-149)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 861003Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 862528Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (1 family) (S)
    C-terminal domain is beta/alpha barrel
  5. 862529Family d.58.9.1: Ribulose 1,5-bisphosphate carboxylase-oxygenase [54967] (1 protein)
  6. 862530Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [54968] (12 species)
  7. 862653Species Galdieria partita [TaxId:83374] [54971] (2 PDB entries)
  8. 862655Domain d1bwvc2: 1bwv C:7-149 [39279]
    Other proteins in same PDB: d1bwva1, d1bwvc1, d1bwve1, d1bwvg1, d1bwvs_, d1bwvu_, d1bwvw_, d1bwvy_

Details for d1bwvc2

PDB Entry: 1bwv (more details), 2.4 Å

PDB Description: Activated Ribulose 1,5-Bisphosphate Carboxylase/Oxygenase (RUBISCO) Complexed with the Reaction Intermediate Analogue 2-Carboxyarabinitol 1,5-Bisphosphate
PDB Compounds: (C:) protein (ribulose bisphosphate carboxylase)

SCOP Domain Sequences for d1bwvc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bwvc2 d.58.9.1 (C:7-149) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Galdieria partita [TaxId: 83374]}
riknsryesgvipyakmgywnpdyqvkdtdvlalfrvtpqpgvdpieaaaavagesstat
wtvvwtdlltaadlyrakaykvdqvpnnpeqyfayiayeldlfeegsianltasiignvf
gfkavkalrledmrlplaylktfq

SCOP Domain Coordinates for d1bwvc2:

Click to download the PDB-style file with coordinates for d1bwvc2.
(The format of our PDB-style files is described here.)

Timeline for d1bwvc2: