Lineage for d1bwvc2 (1bwv C:7-149)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 32366Fold d.58: Ferredoxin-like [54861] (36 superfamilies)
  4. 32762Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (1 family) (S)
  5. 32763Family d.58.9.1: Ribulose 1,5-bisphosphate carboxylase-oxygenase [54967] (1 protein)
  6. 32764Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [54968] (6 species)
  7. 32770Species Galdieria partita [TaxId:83374] [54971] (1 PDB entry)
  8. 32772Domain d1bwvc2: 1bwv C:7-149 [39279]
    Other proteins in same PDB: d1bwva1, d1bwvc1, d1bwve1, d1bwvg1, d1bwvs_, d1bwvu_, d1bwvw_, d1bwvy_

Details for d1bwvc2

PDB Entry: 1bwv (more details), 2.4 Å

PDB Description: Activated Ribulose 1,5-Bisphosphate Carboxylase/Oxygenase (RUBISCO) Complexed with the Reaction Intermediate Analogue 2-Carboxyarabinitol 1,5-Bisphosphate

SCOP Domain Sequences for d1bwvc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bwvc2 d.58.9.1 (C:7-149) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Galdieria partita}
riknsryesgvipyakmgywnpdyqvkdtdvlalfrvtpqpgvdpieaaaavagesstat
wtvvwtdlltaadlyrakaykvdqvpnnpeqyfayiayeldlfeegsianltasiignvf
gfkavkalrledmrlplaylktfq

SCOP Domain Coordinates for d1bwvc2:

Click to download the PDB-style file with coordinates for d1bwvc2.
(The format of our PDB-style files is described here.)

Timeline for d1bwvc2: