![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (2 families) ![]() C-terminal domain is beta/alpha barrel |
![]() | Family d.58.9.1: Ribulose 1,5-bisphosphate carboxylase-oxygenase [54967] (1 protein) |
![]() | Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [54968] (13 species) |
![]() | Species Galdieria partita [TaxId:83374] [54971] (2 PDB entries) |
![]() | Domain d1bwvc2: 1bwv C:7-149 [39279] Other proteins in same PDB: d1bwva1, d1bwvc1, d1bwve1, d1bwvg1, d1bwvs_, d1bwvu_, d1bwvw_, d1bwvy_ complexed with cap, mg |
PDB Entry: 1bwv (more details), 2.4 Å
SCOPe Domain Sequences for d1bwvc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bwvc2 d.58.9.1 (C:7-149) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Galdieria partita [TaxId: 83374]} riknsryesgvipyakmgywnpdyqvkdtdvlalfrvtpqpgvdpieaaaavagesstat wtvvwtdlltaadlyrakaykvdqvpnnpeqyfayiayeldlfeegsianltasiignvf gfkavkalrledmrlplaylktfq
Timeline for d1bwvc2: