SCOPe 2.07: Domain d6vrga1: 6vrg A:1-45

Lineage for d6vrga1 (6vrg A:1-45)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.10: N-terminal Zn binding domain of HIV integrase [46919] (2 families)

5. Family a.4.10.1: N-terminal Zn binding domain of HIV integrase [46920] (1 protein)
   Zn-binding site is near the C-terminus

6. Protein N-terminal Zn binding domain of HIV integrase [46921] (2 species)

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [46922] (8 PDB entries)

8. Domain d6vrga1: 6vrg A:1-45 [392786]
   Other proteins in same PDB: d6vrga2, d6vrgb2, d6vrgc2, d6vrgd2
   automated match to d1k6yb1
   complexed with k, po4, zn

Details for d6vrga1

PDB Entry: 6vrg, 2.4 Å

PDB Description: structure of hiv-1 integrase with native amino-terminal sequence

PDB Compounds: (A:) integrase

SCOPe Domain Sequences for d6vrga1:

Sequence; same for both SEQRES and ATOM records:

>d6vrga1 a.4.10.1 (A:1-45) N-terminal Zn binding domain of HIV integrase {Human immunodeficiency virus type 1 [TaxId: 11676]}
fldgidkaqeehekyhsnwramasdfnlppvvakeivascdkcql

Timeline for d6vrga1:

• d6vrga1 is new in SCOPe 2.07-stable
  
• d6vrga1 appears in the current release, SCOPe 2.08