Class a: All alpha proteins [46456] (289 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.10: N-terminal Zn binding domain of HIV integrase [46919] (2 families) |
Family a.4.10.1: N-terminal Zn binding domain of HIV integrase [46920] (1 protein) Zn-binding site is near the C-terminus |
Protein N-terminal Zn binding domain of HIV integrase [46921] (2 species) |
Species Human immunodeficiency virus type 1 [TaxId:11676] [46922] (8 PDB entries) |
Domain d6vrga1: 6vrg A:1-45 [392786] Other proteins in same PDB: d6vrga2, d6vrgb2, d6vrgc2, d6vrgd2 automated match to d1k6yb1 complexed with k, po4, zn |
PDB Entry: 6vrg (more details), 2.4 Å
SCOPe Domain Sequences for d6vrga1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6vrga1 a.4.10.1 (A:1-45) N-terminal Zn binding domain of HIV integrase {Human immunodeficiency virus type 1 [TaxId: 11676]} fldgidkaqeehekyhsnwramasdfnlppvvakeivascdkcql
Timeline for d6vrga1: