SCOPe 2.08: Domain d6voob3: 6voo B:373-503

Lineage for d6voob3 (6voo B:373-503)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.69: Left-handed superhelix [47916] (4 superfamilies)
   core: 4-5 helices; bundle; left-handed superhelix

4. Superfamily a.69.1: C-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [47917] (4 families)

5. Family a.69.1.0: automated matches [254233] (1 protein)
   not a true family

6. Protein automated matches [254528] (17 species)
   not a true protein

7. Species Spinach (Spinacia oleracea) [TaxId:3562] [352455] (2 PDB entries)

8. Domain d6voob3: 6voo B:373-503 [392767]
   Other proteins in same PDB: d6vooa1, d6vooa2, d6voob1, d6voob2, d6vooc1, d6vooc2, d6vood1, d6vood2, d6vooe1, d6vooe2, d6voof1, d6voof2
   automated match to d1maba1
   complexed with adp, atp, ttx

Details for d6voob3

PDB Entry: 6voo, 3.05 Å

PDB Description: chloroplast atp synthase (r1, cf1)

PDB Compounds: (B:) ATP synthase subunit alpha, chloroplastic

SCOPe Domain Sequences for d6voob3:

Sequence; same for both SEQRES and ATOM records:

>d6voob3 a.69.1.0 (B:373-503) automated matches {Spinach (Spinacia oleracea) [TaxId: 3562]}
ikamkkvagklklelaqfaeleafaqfasdldkatqnqlargqrlrellkqpqsapltve
eqvmtiytgtngyldsleldqvrkylvelrtyvktnkpefqeiisstktfteeaeallke
aiqeqmerfll

Timeline for d6voob3:

• d6voob3 first appeared in SCOPe 2.07