Lineage for d6vooe3 (6voo E:378-496)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2717308Fold a.69: Left-handed superhelix [47916] (4 superfamilies)
    core: 4-5 helices; bundle; left-handed superhelix
  4. 2717309Superfamily a.69.1: C-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [47917] (4 families) (S)
  5. 2717538Family a.69.1.0: automated matches [254233] (1 protein)
    not a true family
  6. 2717539Protein automated matches [254528] (17 species)
    not a true protein
  7. 2717675Species Spinach (Spinacia oleracea) [TaxId:3562] [352455] (2 PDB entries)
  8. 2717680Domain d6vooe3: 6voo E:378-496 [392763]
    Other proteins in same PDB: d6vooa1, d6vooa2, d6voob1, d6voob2, d6vooc1, d6vooc2, d6vood1, d6vood2, d6vooe1, d6vooe2, d6voof1, d6voof2
    automated match to d2qe7d3
    complexed with adp, atp, ttx

Details for d6vooe3

PDB Entry: 6voo (more details), 3.05 Å

PDB Description: chloroplast atp synthase (r1, cf1)
PDB Compounds: (E:) ATP synthase subunit beta, chloroplastic

SCOPe Domain Sequences for d6vooe3:

Sequence; same for both SEQRES and ATOM records: (download)

>d6vooe3 a.69.1.0 (E:378-496) automated matches {Spinach (Spinacia oleracea) [TaxId: 3562]}
rivgeehyeiaqrvketlqrykelqdiiailgldelseedrltvararkierflsqpffv
aevftgspgkyvglaetirgfqlilsgeldslpeqafylvgnideatakamnlemeskl

SCOPe Domain Coordinates for d6vooe3:

Click to download the PDB-style file with coordinates for d6vooe3.
(The format of our PDB-style files is described here.)

Timeline for d6vooe3: